Lineage for d6hbcd_ (6hbc D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957834Protein automated matches [190066] (7 species)
    not a true protein
  7. 2957937Species Synechococcus elongatus [TaxId:1140] [361116] (1 PDB entry)
  8. 2957938Domain d6hbcd_: 6hbc D: [361137]
    Other proteins in same PDB: d6hbcb1, d6hbcb2, d6hbcc1, d6hbcc2
    automated match to d1rsci_

Details for d6hbcd_

PDB Entry: 6hbc (more details), 2.78 Å

PDB Description: structure of the repeat unit in the network formed by ccmm and rubisco from synechococcus elongatus
PDB Compounds: (D:) Ribulose 1,5-bisphosphate carboxylase small subunit

SCOPe Domain Sequences for d6hbcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hbcd_ d.73.1.1 (D:) automated matches {Synechococcus elongatus [TaxId: 1140]}
mktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklpl
fdckspqqvldevrecrseygdcyirvagfdnikqcqtvsfivhrp

SCOPe Domain Coordinates for d6hbcd_:

Click to download the PDB-style file with coordinates for d6hbcd_.
(The format of our PDB-style files is described here.)

Timeline for d6hbcd_: