Lineage for d6hbcb1 (6hbc B:20-147)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559642Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2559643Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2559644Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2559817Species Synechococcus elongatus [TaxId:1140] [361122] (1 PDB entry)
  8. 2559818Domain d6hbcb1: 6hbc B:20-147 [361132]
    Other proteins in same PDB: d6hbcb2, d6hbcc2, d6hbcd_, d6hbce_
    automated match to d1rsca2

Details for d6hbcb1

PDB Entry: 6hbc (more details), 2.78 Å

PDB Description: structure of the repeat unit in the network formed by ccmm and rubisco from synechococcus elongatus
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6hbcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hbcb1 d.58.9.1 (B:20-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus elongatus [TaxId: 1140]}
ykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwttvwtdlltdmdr
ykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfkairslrledir
fpvalvkt

SCOPe Domain Coordinates for d6hbcb1:

Click to download the PDB-style file with coordinates for d6hbcb1.
(The format of our PDB-style files is described here.)

Timeline for d6hbcb1: