Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
Species Synechococcus elongatus [TaxId:1140] [361122] (1 PDB entry) |
Domain d6hbcb1: 6hbc B:20-147 [361132] Other proteins in same PDB: d6hbcb2, d6hbcc2, d6hbcd_, d6hbce_ automated match to d1rsca2 |
PDB Entry: 6hbc (more details), 2.78 Å
SCOPe Domain Sequences for d6hbcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hbcb1 d.58.9.1 (B:20-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus elongatus [TaxId: 1140]} ykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwttvwtdlltdmdr ykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfkairslrledir fpvalvkt
Timeline for d6hbcb1:
View in 3D Domains from other chains: (mouse over for more information) d6hbcc1, d6hbcc2, d6hbcd_, d6hbce_ |