SCOP 1.59: Domain d1rnt__: 1rnt -

Lineage for d1rnt__ (1rnt -)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)

4. Superfamily d.1.1: Microbial ribonucleases [53933] (1 family)

5. Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Aspergillus oryzae [TaxId:5062] [53940] (59 PDB entries)

8. Domain d1rnt__: 1rnt - [36113]

Details for d1rnt__

PDB Entry: 1rnt, 1.9 Å

PDB Description: restrained least-squares refinement of the crystal structure of the ribonuclease t1(asterisk)2(prime)-guanylic acid complex at 1.9 angstroms resolution

SCOP Domain Sequences for d1rnt__:

Sequence; same for both SEQRES and ATOM records:

>d1rnt__ d.1.1.1 (-) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1rnt__:

• d1rnt__ first appeared (with stable ids) in SCOP 1.55
  
• d1rnt__ appears in SCOP 1.57
  
• d1rnt__ appears in SCOP 1.61
  
• d1rnt__ appears in the current release, SCOPe 2.08, called d1rnta_