Lineage for d6hprc_ (6hpr C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546288Protein automated matches [190124] (13 species)
    not a true protein
  7. 2546306Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)
  8. 2546324Domain d6hprc_: 6hpr C: [361127]
    Other proteins in same PDB: d6hprb_, d6hprd_
    automated match to d2clwa_
    complexed with zn

Details for d6hprc_

PDB Entry: 6hpr (more details), 1.7 Å

PDB Description: crystal structure of ciap1 ring domain bound to ubch5b-ub and a non- covalent ub
PDB Compounds: (C:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d6hprc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hprc_ d.20.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d6hprc_:

Click to download the PDB-style file with coordinates for d6hprc_.
(The format of our PDB-style files is described here.)

Timeline for d6hprc_: