Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (7 species) not a true protein |
Species Synechococcus elongatus [TaxId:1140] [361116] (1 PDB entry) |
Domain d6hbce_: 6hbc E: [361117] Other proteins in same PDB: d6hbcb1, d6hbcb2, d6hbcc1, d6hbcc2 automated match to d1rsci_ |
PDB Entry: 6hbc (more details), 2.78 Å
SCOPe Domain Sequences for d6hbce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hbce_ d.73.1.1 (E:) automated matches {Synechococcus elongatus [TaxId: 1140]} mktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklpl fdckspqqvldevrecrseygdcyirvagfdnikqcqtvsfivhrp
Timeline for d6hbce_: