Lineage for d6hqwa_ (6hqw A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (81 species)
    not a true protein
  7. 2332048Species Novosphingobium aromaticivorans [TaxId:48935] [229374] (4 PDB entries)
  8. 3061052Domain d6hqwa_: 6hqw A: [361114]
    automated match to d5h1za_
    complexed with hem

Details for d6hqwa_

PDB Entry: 6hqw (more details), 2.9 Å

PDB Description: cytochrome p450-153 from novosphingobium aromaticivorans
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d6hqwa_:

Sequence, based on SEQRES records: (download)

>d6hqwa_ a.104.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
shpwdvsrsdiyvedrwqpifaemrakapvnrvpdspygaywnvashkaimhveslpelf
ssswqyggitigdppedvdpqklaerqlpmfiamdrpdhtgqrrtvapaftpakmvemea
eirrrtasvldslpwgerfdwvdkvsielttgmlailfgfpwadrrlltfwsdwagdvel
tlareladtrfgflgemahyfqrlwgarmqappsgdlismmihseamnhmspqefmgnlv
llivggndttrntmsgivhaldkfpdqrellerdaslipnavqeciryvtplahmrrtat
adtelfgnqikagekvilwyisanrdetvfenpdklmvdrpnarrhlsfghgihrcvgar
laelqlrilleemherrmrvrvagevervranfvhgfrklevele

Sequence, based on observed residues (ATOM records): (download)

>d6hqwa_ a.104.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
shpwdvsrsdiyvedrwqpifaemrakapvnrvpdspygaywnvashkaimhveslpelf
ssswqyggitigdppedvdpqklaerqlpmfiamdrpdhtgqrrtvapaftpakmvemea
eirrrtasvldslpwgerfdwvdkvsielttgmlailfgfpwrlltfwsdwagltlarel
adtrfgflgemahyfqrlwgarmqgdlismmihseamnhmspqefmgnlvllivggndtt
rntmsgivhaldkfpdqrellerdaslipnavqeciryvtplahmrrtatadtelfgnqi
kagekvilwyisanrdetvfenpdklmvdrpnarrhlsfghgihrcvgarlaelqlrill
eemherrmrvrvagevervranfvhgfrklevele

SCOPe Domain Coordinates for d6hqwa_:

Click to download the PDB-style file with coordinates for d6hqwa_.
(The format of our PDB-style files is described here.)

Timeline for d6hqwa_:

  • d6hqwa_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13