Lineage for d6h7ab_ (6h7a B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734855Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2734856Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2734889Family a.144.1.0: automated matches [254226] (1 protein)
    not a true family
  6. 2734890Protein automated matches [254511] (2 species)
    not a true protein
  7. 2734891Species Leishmania major [TaxId:5664] [361100] (1 PDB entry)
  8. 2734893Domain d6h7ab_: 6h7a B: [361108]
    Other proteins in same PDB: d6h7aa2
    automated match to d2rqhb_

Details for d6h7ab_

PDB Entry: 6h7a (more details), 2.03 Å

PDB Description: structure of leishmania pabp1 (domain j).
PDB Compounds: (B:) PABP1 domain J

SCOPe Domain Sequences for d6h7ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7ab_ a.144.1.0 (B:) automated matches {Leishmania major [TaxId: 5664]}
lppitpqelesmspqeqraalgdrlflkvyeiapelapkitgmflemkpkeayellndqk
rleervtealcvlkahqta

SCOPe Domain Coordinates for d6h7ab_:

Click to download the PDB-style file with coordinates for d6h7ab_.
(The format of our PDB-style files is described here.)

Timeline for d6h7ab_: