SCOPe 2.08: Domain d6bthb1: 6bth B:0-133

Lineage for d6bthb1 (6bth B:0-133)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (90 PDB entries)

8. Domain d6bthb1: 6bth B:0-133 [361106]
   Other proteins in same PDB: d6btha2, d6bthb2
   automated match to d1eiia_
   complexed with ecb, peg

Details for d6bthb1

PDB Entry: 6bth, 1.35 Å

PDB Description: crystal structure of human cellular retinol binding protein 2 (crbp2) in complex with 2-arachidonoylglycerol (2-ag)

PDB Compounds: (B:) Retinol-binding protein 2

SCOPe Domain Sequences for d6bthb1:

Sequence; same for both SEQRES and ATOM records:

>d6bthb1 b.60.1.2 (B:0-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
tcgdqvcrqvfkkk

Timeline for d6bthb1:

• d6bthb1 first appeared in SCOPe 2.07