![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (2 proteins) automatically mapped to Pfam PF08943 |
![]() | Protein automated matches [190931] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [361103] (2 PDB entries) |
![]() | Domain d6gpea_: 6gpe A: [361105] automated match to d1jr7a_ complexed with fe2 |
PDB Entry: 6gpe (more details), 2.2 Å
SCOPe Domain Sequences for d6gpea_:
Sequence, based on SEQRES records: (download)
>d6gpea_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 83333]} qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy arfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhldd wehldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfee gvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfa yasnhyqthq
>d6gpea_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 83333]} qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy arfvvkhrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhpl arrpmrfaakdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgils vpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthq
Timeline for d6gpea_: