Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (2 proteins) automatically mapped to Pfam PF08943 |
Protein automated matches [190931] (3 species) not a true protein |
Species Escherichia coli [TaxId:83333] [361103] (2 PDB entries) |
Domain d6gpeb_: 6gpe B: [361104] automated match to d1jr7a_ complexed with fe2 |
PDB Entry: 6gpe (more details), 2.2 Å
SCOPe Domain Sequences for d6gpeb_:
Sequence, based on SEQRES records: (download)
>d6gpeb_ b.82.2.3 (B:) automated matches {Escherichia coli [TaxId: 83333]} ysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlcan qlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyyar fvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwe hldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegv wlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfaya snhyqthq
>d6gpeb_ b.82.2.3 (B:) automated matches {Escherichia coli [TaxId: 83333]} ysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlcan qlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyyar fvvknhrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhpla rrpmrfaappkdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgil svpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthq
Timeline for d6gpeb_: