SCOP 1.57: Domain d7gspb_: 7gsp B:

Lineage for d7gspb_ (7gsp B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)

4. Superfamily d.1.1: Microbial ribonucleases [53933] (1 family)

5. Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Aspergillus oryzae [TaxId:5062] [53940] (59 PDB entries)

8. Domain d7gspb_: 7gsp B: [36109]

Details for d7gspb_

PDB Entry: 7gsp, 1.9 Å

PDB Description: ribonuclease t1/2',3'-cgps, non-productive

SCOP Domain Sequences for d7gspb_:

Sequence; same for both SEQRES and ATOM records:

>d7gspb_ d.1.1.1 (B:) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d7gspb_:

• d7gspb_ first appeared (with stable ids) in SCOP 1.55
  
• d7gspb_ appears in SCOP 1.59
  
• d7gspb_ appears in the current release, SCOPe 2.08