Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Streptomyces acidiscabies [TaxId:1116232] [361072] (2 PDB entries) |
Domain d6f0ba_: 6f0b A: [361087] automated match to d4z5pa_ complexed with c8h, hem |
PDB Entry: 6f0b (more details), 2.8 Å
SCOPe Domain Sequences for d6f0ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f0ba_ a.104.1.0 (A:) automated matches {Streptomyces acidiscabies [TaxId: 1116232]} splepyhiypeakscpvakvglwngtpahvfsgyedvrtvlqdrrfssdsrrpnfteltp tlqsqaaappfvrtdnpdhrrlrgtiareflpkhiellrpaireivqgvldglaetappq dmleafavpvasatvfrllgipaedralltrcvkgvvsavgsedegaevfrtlgeyiggl vqdpselpedslirrlvtgpyqekqltfhetigvilmlivggydttastislslvsyalq pekfsvvhehperipllveellryhtvsqlglgriatedvevggvtvragqmvvaalpla nrdesvfpnpdeldfdrpsvphvgfgygphqcvgqalarvelqeaipavirrlpgmrlac aledlpfrhdmatygihelpmtw
Timeline for d6f0ba_: