![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Myceliophthora thermophila [TaxId:78579] [361079] (1 PDB entry) |
![]() | Domain d6f5ka2: 6f5k A:163-343 [361081] automated match to d2q9oa2 complexed with 2pe, ca, cu, nag, oh |
PDB Entry: 6f5k (more details), 1.62 Å
SCOPe Domain Sequences for d6f5ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f5ka2 b.6.1.0 (A:163-343) automated matches {Myceliophthora thermophila [TaxId: 78579]} ydtdlgvfpisdyyyssadelveltknsgapfsdnvlfngtakhpetgegeyanvtltpg rrhrlrlintsvenhfqvslvnhtmtiiaadmvpvnamtvdslflgvgqrydvvieasrt pgnywfnvtfgggllcggsrnpypaaifhyagapggpptdegkapvdhncldlpnlkpvv a
Timeline for d6f5ka2: