Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Myceliophthora thermophila [TaxId:78579] [361079] (1 PDB entry) |
Domain d6f5ka1: 6f5k A:2-162 [361080] automated match to d2q9oa1 complexed with 2pe, bma, ca, cu, man, nag, oh |
PDB Entry: 6f5k (more details), 1.62 Å
SCOPe Domain Sequences for d6f5ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f5ka1 b.6.1.0 (A:2-162) automated matches {Myceliophthora thermophila [TaxId: 78579]} qscntpsnracwtdgydintdyevdspdtgvvrpytltltevdnwtgpdgvvkekvmlvn nsiigptifadwgdtiqvtvinnletngtsihwhglhqkgtnlhdgangitecpippkgg rkvyrfkaqqygtswyhshfsaqygngvvgaiqingpaslp
Timeline for d6f5ka1: