Lineage for d6f5ka1 (6f5k A:2-162)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772547Species Myceliophthora thermophila [TaxId:78579] [361079] (1 PDB entry)
  8. 2772548Domain d6f5ka1: 6f5k A:2-162 [361080]
    automated match to d2q9oa1
    complexed with 2pe, ca, cu, nag, oh

Details for d6f5ka1

PDB Entry: 6f5k (more details), 1.62 Å

PDB Description: crystal structure of laccase from myceliophthora thermophila
PDB Compounds: (A:) Extracellular laccase, lcc1

SCOPe Domain Sequences for d6f5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f5ka1 b.6.1.0 (A:2-162) automated matches {Myceliophthora thermophila [TaxId: 78579]}
qscntpsnracwtdgydintdyevdspdtgvvrpytltltevdnwtgpdgvvkekvmlvn
nsiigptifadwgdtiqvtvinnletngtsihwhglhqkgtnlhdgangitecpippkgg
rkvyrfkaqqygtswyhshfsaqygngvvgaiqingpaslp

SCOPe Domain Coordinates for d6f5ka1:

Click to download the PDB-style file with coordinates for d6f5ka1.
(The format of our PDB-style files is described here.)

Timeline for d6f5ka1: