Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Streptomyces acidiscabies [TaxId:1116232] [361072] (2 PDB entries) |
Domain d6f0ca_: 6f0c A: [361073] automated match to d4z5pa_ complexed with c8b, hem, oxy |
PDB Entry: 6f0c (more details), 1.7 Å
SCOPe Domain Sequences for d6f0ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f0ca_ a.104.1.0 (A:) automated matches {Streptomyces acidiscabies [TaxId: 1116232]} splepyhiypeakscpvakvglwngtpahvfsgyedvrtvlqdrrfssdsrrpnfteltp tlqsqaaappfvrtdnpdhrrlrgtiareflpkhiellrpaireivqgvldglaetappq dmleafavpvasatvfrllgipaedralltrcvkgvvsavgsedegaevfrtlgeyiggl vqdpselpedslirrlvtgpyqekqltfhetigvilmlivggydttastislslvsyalq pekfsvvhehperipllveellryhtvsqlglgriatedvevggvtvragqmvvaalpla nrdesvfpnpdeldfdrpsvphvgfgygphqcvgqalarvelqeaipavirrlpgmrlac aledlpfrhdmatygihelpmtw
Timeline for d6f0ca_: