SCOPe 2.07: Domain d6a34a_: 6a34 A:

Lineage for d6a34a_ (6a34 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (16 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [361003] (2 PDB entries)

8. Domain d6a34a_: 6a34 A: [361067]
   automated match to d1t9ka_
   complexed with hez

Details for d6a34a_

PDB Entry: 6a34, 2.3 Å

PDB Description: crystal structure of 5-methylthioribose 1-phosphate isomerase from pyrococcus horikoshii ot3 - form i

PDB Compounds: (A:) Putative methylthioribose-1-phosphate isomerase

SCOPe Domain Sequences for d6a34a_:

Sequence; same for both SEQRES and ATOM records:

>d6a34a_ c.124.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
meirytpkeltklprtveyknksvyminqrllpkefkvekfskveevaeaiknmtvrgap
aigaaagfglalyaetskaktkeefldgfekayeilkntrptavnlfwalnrikklveeh
sedpldeikrlivqeaykiadedveanlrmghygaevlpegnilthcnagslatvhlgtv
gsvvrvmhkdgslkllwldetrpvlqgarlsaweysydglnvkliadnaaafvmqqgfvd
aiivgadrivangdfankigtymlavlarehgipffavaplssidmelksgkdipieers
peevltcggcriapdvpvynpafdvtphkyltgiitdrgvvwppfkrnlkklfevn

Timeline for d6a34a_:

• d6a34a_ is new in SCOPe 2.07-stable
  
• d6a34a_ appears in the current release, SCOPe 2.08