Lineage for d6ez2a_ (6ez2 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. Protein automated matches [190543] (128 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188340] (94 PDB entries)
  8. Domain d6ez2a_: 6ez2 A: [361062]
    automated match to d4tpka_
    complexed with cl, edo, gol, nag

Details for d6ez2a_

PDB Entry: 6ez2 (more details), 2.7 Å

PDB Description: human butyrylcholinesterase carbamylated.
PDB Compounds: (A:) cholinesterase

SCOPe Domain Sequences for d6ez2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ez2a_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkya
nsccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgt
sslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkni
aafggnpksvtlfgexagaasvslhllspgshslftrailqsgsfnapwavtslyearnr
tlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdm
pdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvs
efgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfe
hrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpne
tqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

SCOPe Domain Coordinates for d6ez2a_ are not available.

Timeline for d6ez2a_:

Domains from other chains:
(mouse over for more information)
d6ez2b_