Lineage for d6ezlb_ (6ezl B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 3060995Species Trypanosoma cruzi [TaxId:353153] [361057] (1 PDB entry)
  8. 3060996Domain d6ezlb_: 6ezl B: [361058]
    automated match to d4wb0a_
    complexed with plp

Details for d6ezlb_

PDB Entry: 6ezl (more details), 2.07 Å

PDB Description: crystal structure of aspartate aminotransferase from trypanosoma cruzi at 2.07 angstrom resolution
PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d6ezlb_:

Sequence, based on SEQRES records: (download)

>d6ezlb_ c.67.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
clwnniaalpadpifsaslvakkapepkadliigayrdaeghpyplnvvrkaeqrllemn
adkeylpmsgyapfieeslkiaygdsvarenvvgiqglsgtgslsigacflarvlsrdtp
vyisdptwpnhyavmaaanltdlrkyryydnakrcidfdglledlngapegsivilhaca
hnptgmdptheqwakilevfqarrlipffdsayqgyatgsldndaysirlfarqgmemll
aqsysknmglyaervgvcsivtanpkkapliksqletivrsqystppahgarvaylvlsd
pelragweqelrvmstrvlemrqalydglkrlgtpgswehiiqqvgmfsylgltkaqcek
lierrvfvlpsgranmagltkrsvellvkgidevvrtvt

Sequence, based on observed residues (ATOM records): (download)

>d6ezlb_ c.67.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
clwnniaalpadpifsaslvakkapepkadliigayrdaeghpyplnvvrkaeqrllelp
msgyapfieeslkiaygdsvarenvvgiqglsgtgslsigacflarvlsrdtpvyisdpt
wpnhyavmaaanltdlrkyryydnakrcidfdglledlngapegsivilhacahnptgmd
ptheqwakilevfqarrlipffdsayqgyatgsldndaysirlfarqgmemllaqsyskn
mglyaervgvcsivtanpkkapliksqletivrsqystppahgarvaylvlsdpelragw
eqelrvmstrvlemrqalydglkrlgtpgswehiiqqvgmfsylgltkaqceklierrvf
vlpsgranmagltkrsvellvkgidevvrtvt

SCOPe Domain Coordinates for d6ezlb_:

Click to download the PDB-style file with coordinates for d6ezlb_.
(The format of our PDB-style files is described here.)

Timeline for d6ezlb_:

  • d6ezlb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13