Lineage for d6b4sb1 (6b4s B:285-454)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815203Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2815204Protein automated matches [190388] (30 species)
    not a true protein
  7. 2815212Species Bertholletia excelsa [TaxId:3645] [361007] (1 PDB entry)
  8. 2815215Domain d6b4sb1: 6b4s B:285-454 [361039]
    automated match to d5wpwa2

Details for d6b4sb1

PDB Entry: 6b4s (more details), 2.04 Å

PDB Description: crystal structure of brazil nut (bertholletia excelsa) allergen ber e 2
PDB Compounds: (B:) 11S globulin

SCOPe Domain Sequences for d6b4sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b4sb1 b.82.1.0 (B:285-454) automated matches {Bertholletia excelsa [TaxId: 3645]}
icsatfiqnidnpaeadfynpragrlttvnslkvpiltflqlsamkgvlyenammaplwr
lnansvvyavrgearvqivdhrgetvfddnlregqmvvvpqnfvvvkqagsrgfewvvfn
tndnalfstaagrtsplrgipvgvlanayrlsqeearriklnrdeavlfn

SCOPe Domain Coordinates for d6b4sb1:

Click to download the PDB-style file with coordinates for d6b4sb1.
(The format of our PDB-style files is described here.)

Timeline for d6b4sb1: