Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (30 species) not a true protein |
Species Bertholletia excelsa [TaxId:3645] [361007] (1 PDB entry) |
Domain d6b4sb1: 6b4s B:285-454 [361039] automated match to d5wpwa2 |
PDB Entry: 6b4s (more details), 2.04 Å
SCOPe Domain Sequences for d6b4sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b4sb1 b.82.1.0 (B:285-454) automated matches {Bertholletia excelsa [TaxId: 3645]} icsatfiqnidnpaeadfynpragrlttvnslkvpiltflqlsamkgvlyenammaplwr lnansvvyavrgearvqivdhrgetvfddnlregqmvvvpqnfvvvkqagsrgfewvvfn tndnalfstaagrtsplrgipvgvlanayrlsqeearriklnrdeavlfn
Timeline for d6b4sb1: