SCOPe 2.07: Domain d6dqym2: 6dqy M:91-209

Lineage for d6dqym2 (6dqy M:91-209)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries)

8. Domain d6dqym2: 6dqy M:91-209 [361029]
   Other proteins in same PDB: d6dqya1, d6dqyb1, d6dqyc1, d6dqyd1, d6dqye1, d6dqyf1, d6dqyg1, d6dqyh1, d6dqyi1, d6dqyj1, d6dqyk1, d6dqyl1, d6dqym1, d6dqyn1, d6dqyo1, d6dqyp1, d6dqyq1, d6dqyr1, d6dqys1, d6dqyt1, d6dqyu1, d6dqyv1, d6dqyw1, d6dqyx1
   automated match to d5tira2
   complexed with mn

Details for d6dqym2

PDB Entry: 6dqy, 2.3 Å

PDB Description: crystal structure analysis of superoxide dismutase from trichoderma reesei

PDB Compounds: (M:) superoxide dismutase

SCOPe Domain Sequences for d6dqym2:

Sequence; same for both SEQRES and ATOM records:

>d6dqym2 d.44.1.0 (M:91-209) automated matches {Hypocrea jecorina [TaxId: 431241]}
pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdqd
pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfkgdredafkilk

Timeline for d6dqym2:

• d6dqym2 is new in SCOPe 2.07-stable
  
• d6dqym2 appears in the current release, SCOPe 2.08