Lineage for d6clza_ (6clz A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416783Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2416784Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2416819Family b.66.1.0: automated matches [196610] (1 protein)
    not a true family
  6. 2416820Protein automated matches [196611] (2 species)
    not a true protein
  7. 2416821Species Human (Homo sapiens) [TaxId:9606] [196612] (9 PDB entries)
  8. 2416835Domain d6clza_: 6clz A: [361016]
    automated match to d3c7xa_
    complexed with cl, na, px4

Details for d6clza_

PDB Entry: 6clz (more details)

PDB Description: mt1-mmp hpx domain with blade 4 loop bound to nanodiscs
PDB Compounds: (A:) Matrix metalloproteinase-14

SCOPe Domain Sequences for d6clza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6clza_ b.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnicdgnfdtvamlrgemfvfkerwfwrvrnnqvmdgypmpigqfwrglpasintayerk
dgkfvffkgdkhwvfdeaslepgypkhikelgrglptdkidaalfwmpngktyffrgnky
yrfneelravdseypknikvwegipesprgsfmgsdevftyfykgnkywkfnnqklkvep
gypksalrdwmgcpsg

SCOPe Domain Coordinates for d6clza_:

Click to download the PDB-style file with coordinates for d6clza_.
(The format of our PDB-style files is described here.)

Timeline for d6clza_: