Lineage for d6gu3c_ (6gu3 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967083Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2967084Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2967085Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2967112Protein automated matches [227065] (3 species)
    not a true protein
  7. 2967121Species Human (Homo sapiens) [TaxId:9606] [273041] (10 PDB entries)
  8. 2967132Domain d6gu3c_: 6gu3 C: [360988]
    Other proteins in same PDB: d6gu3a1, d6gu3a2
    automated match to d1cksb_
    complexed with fb8

Details for d6gu3c_

PDB Entry: 6gu3 (more details), 2.65 Å

PDB Description: cdk1/cyclinb/cks2 in complex with azd5438
PDB Compounds: (C:) Cyclin-dependent kinases regulatory subunit 2

SCOPe Domain Sequences for d6gu3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gu3c_ d.97.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymih
epephillfrrplp

SCOPe Domain Coordinates for d6gu3c_:

Click to download the PDB-style file with coordinates for d6gu3c_.
(The format of our PDB-style files is described here.)

Timeline for d6gu3c_: