SCOPe 2.07: Domain d5w2qa1: 5w2q A:3-259

Lineage for d5w2qa1 (5w2q A:3-259)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [196910] (13 PDB entries)

8. Domain d5w2qa1: 5w2q A:3-259 [360986]
   automated match to d2wgea1
   complexed with 6u5, gol, ipa, na, tce

Details for d5w2qa1

PDB Entry: 5w2q, 1.8 Å

PDB Description: crystal structure of mycobacterium tuberculosis kasa in complex with 6u5

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d5w2qa1:

Sequence; same for both SEQRES and ATOM records:

>d5w2qa1 c.95.1.0 (A:3-259) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
qpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkigg
hlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaeri
vesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsacssgseaiahaw
rqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfgea
galmlieteehakarga

Timeline for d5w2qa1:

• d5w2qa1 is new in SCOPe 2.07-stable
  
• d5w2qa1 appears in the current release, SCOPe 2.08