![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
![]() | Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) ![]() |
![]() | Family b.53.1.0: automated matches [270315] (1 protein) not a true family |
![]() | Protein automated matches [270316] (3 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [360922] (3 PDB entries) |
![]() | Domain d5zdla2: 5zdl A:338-543 [360963] Other proteins in same PDB: d5zdla1 automated match to d4jxxa2 complexed with atp, cl |
PDB Entry: 5zdl (more details), 2.6 Å
SCOPe Domain Sequences for d5zdla2:
Sequence, based on SEQRES records: (download)
>d5zdla2 b.53.1.0 (A:338-543) automated matches {Thermus thermophilus [TaxId: 300852]} aprvlgvvdplkvvltnyegeewieapywprdipkegtrplpfspelyiertdfslnppk gwkrlapgqrvrlrhayvieledvveeggevrllkarivpgtlganpedgvrpkgvihwv sarhalpvefrlygrlfrtkdpeeggdflqnlnpealvvkrgfiepsvaqdpedtryqle rlgyfwrdpvdsrpealvmnrivplk
>d5zdla2 b.53.1.0 (A:338-543) automated matches {Thermus thermophilus [TaxId: 300852]} aprvlgvvdplkvvltnyegeewieapywprdipkegtrplpfspelyiertdfslnppk gwkrlapgqrvrlrhayvieledvveeggevrllkarivtlganpedgvrpkgvihwvsa rhalpvefrlygrlfrtkdpeeggdflqnlnpealvvkrgfiepsvaqdpedtryqlerl gyfwrdpvdsrpealvmnrivplk
Timeline for d5zdla2: