Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class sigma GST [81351] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [89061] (15 PDB entries) Uniprot O60760; synonym: hematopoietic prostaglandin D synthase |
Domain d5yx1c2: 5yx1 C:76-199 [360957] Other proteins in same PDB: d5yx1a1, d5yx1b1, d5yx1c1, d5yx1d1 automated match to d2cvda1 complexed with gol, gsh, mg, ux4 |
PDB Entry: 5yx1 (more details), 1.39 Å
SCOPe Domain Sequences for d5yx1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yx1c2 a.45.1.1 (C:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
Timeline for d5yx1c2: