Lineage for d6gu7f_ (6gu7 F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573697Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2573698Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2573699Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2573726Protein automated matches [227065] (4 species)
    not a true protein
  7. 2573735Species Desmodus rotundus [TaxId:9430] [360789] (5 PDB entries)
  8. 2573742Domain d6gu7f_: 6gu7 F: [360945]
    Other proteins in same PDB: d6gu7a_, d6gu7c_, d6gu7e_, d6gu7g_
    automated match to d1cksb_
    complexed with fb8

Details for d6gu7f_

PDB Entry: 6gu7 (more details), 2.75 Å

PDB Description: cdk1/cks2 in complex with azd5438
PDB Compounds: (F:) cyclin-dependent kinases regulatory subunit

SCOPe Domain Sequences for d6gu7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gu7f_ d.97.1.1 (F:) automated matches {Desmodus rotundus [TaxId: 9430]}
kqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihepe
phillfrrplp

SCOPe Domain Coordinates for d6gu7f_:

Click to download the PDB-style file with coordinates for d6gu7f_.
(The format of our PDB-style files is described here.)

Timeline for d6gu7f_: