Lineage for d1rgl__ (1rgl -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) 
Protein RNase T1 [53939] (2 species) Species Aspergillus oryzae [TaxId:5062] [53940] (54 PDB entries) 
Domain d1rgl__: 1rgl - [36094]
Details for d1rgl__
PDB Entry: 1rgl (more details), 2 Å
PDB Description: rnase t1 mutant glu46gln binds the inhibitors 2'gmp and 2'amp at the 3' subsite
SCOP Domain Sequences for d1rgl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rgl__ d.1.1.1 (-) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyqgfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
SCOP Domain Coordinates for d1rgl__:
Click to download the PDB-style file with coordinates for d1rgl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rgl__:
- d1rgl__ appears in SCOP 1.57
- d1rgl__ appears in the current release, SCOPe 2.08, called d1rgla_
View in 3D