Lineage for d5z6tb_ (5z6t B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. Protein automated matches [190169] (7 species)
    not a true protein
  7. Species Scheffersomyces stipitis [TaxId:322104] [360899] (2 PDB entries)
  8. Domain d5z6tb_: 5z6t B: [360939]
    automated match to d1mi3a_
    complexed with nap

Details for d5z6tb_

PDB Entry: 5z6t (more details), 2 Å

PDB Description: crystal structure of d-xylose reductase from scheffersomyces stipitis in complex with nadph
PDB Compounds: (B:) NAD(P)H-dependent D-xylose reductase

SCOPe Domain Sequences for d5z6tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z6tb_ c.1.7.1 (B:) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
psiklnsgydmpavgfgcwkvdvdtcseqiyraiktgyrlfdgaedyaneklvgagvkka
idegivkredlfltsklwnnyhhpdnvekalnrtlsdlqvdyvdlflihfpvtfkfvple
ekyppgfycgkgdnfdyedvpiletwkaleklvkagkirsigvsnfpgallldllrgati
kpsvlqvehhpylqqprliefaqsrgiavtayssfgpqsfvelnqgralntsplfeneti
kaiaakhgkspaqvllrwssqrgiaiipksntvprllenkdvnsfdldeqdfadiakldi
nlrfndpwdwdkipifv

SCOPe Domain Coordinates for d5z6tb_ are not available.

Timeline for d5z6tb_:

Domains from other chains:
(mouse over for more information)
d5z6ta_