Lineage for d6gj4b2 (6gj4 B:246-438)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959640Domain d6gj4b2: 6gj4 B:246-438 [360934]
    Other proteins in same PDB: d6gj4a1, d6gj4b1, d6gj4c1, d6gj4d1, d6gj4e_, d6gj4f1, d6gj4f2, d6gj4f3
    automated match to d3rycd2
    complexed with acp, ca, ezw, gdp, gtp, mes, mg

Details for d6gj4b2

PDB Entry: 6gj4 (more details), 2.4 Å

PDB Description: tubulin-6j complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6gj4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gj4b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d6gj4b2:

Click to download the PDB-style file with coordinates for d6gj4b2.
(The format of our PDB-style files is described here.)

Timeline for d6gj4b2: