Lineage for d1bvid_ (1bvi D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170736Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2170737Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2170979Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)
  6. 2170990Protein RNase T1 [53939] (2 species)
  7. 2170993Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)
  8. 2171038Domain d1bvid_: 1bvi D: [36093]
    complexed with 2gp, ca

Details for d1bvid_

PDB Entry: 1bvi (more details), 1.9 Å

PDB Description: ribonuclease t1 (wildtype) complexed with 2'gmp
PDB Compounds: (D:) protein (ribonuclease t1)

SCOPe Domain Sequences for d1bvid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvid_ d.1.1.4 (D:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

SCOPe Domain Coordinates for d1bvid_:

Click to download the PDB-style file with coordinates for d1bvid_.
(The format of our PDB-style files is described here.)

Timeline for d1bvid_: