Lineage for d5zdoa2 (5zdo A:338-543)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. Family b.53.1.0: automated matches [270315] (1 protein)
    not a true family
  6. Protein automated matches [270316] (3 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:300852] [360922] (3 PDB entries)
  8. Domain d5zdoa2: 5zdo A:338-543 [360925]
    Other proteins in same PDB: d5zdoa1
    automated match to d4jxxa2
    complexed with cl

Details for d5zdoa2

PDB Entry: 5zdo (more details), 2.8 Å

PDB Description: crystal structure analysis of ttqrs in co-crystallised with atp
PDB Compounds: (A:) Glutamine-tRNA ligase

SCOPe Domain Sequences for d5zdoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zdoa2 b.53.1.0 (A:338-543) automated matches {Thermus thermophilus [TaxId: 300852]}
aprvlgvvdplkvvltnyegeewieapywprdipkegtrplpfspelyiertdfslnppk
gwkrlapgqrvrlrhayvieledvveeggevrllkarivpgtlganpedgvrpkgvihwv
sarhalpvefrlygrlfrtkdpeeggdflqnlnpealvvkrgfiepsvaqdpedtryqle
rlgyfwrdpvdsrpealvmnrivplk

SCOPe Domain Coordinates for d5zdoa2 are not available.

Timeline for d5zdoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zdoa1