SCOPe 2.08: Domain d5zdoa2: 5zdo A:338-543

Lineage for d5zdoa2 (5zdo A:338-543)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
   barrel, closed; n=6, S=10; complex topology

4. Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families)

5. Family b.53.1.0: automated matches [270315] (1 protein)
   not a true family

6. Protein automated matches [270316] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [360922] (3 PDB entries)

8. Domain d5zdoa2: 5zdo A:338-543 [360925]
   Other proteins in same PDB: d5zdoa1
   automated match to d4jxxa2
   complexed with cl

Details for d5zdoa2

PDB Entry: 5zdo, 2.8 Å

PDB Description: crystal structure analysis of ttqrs in co-crystallised with atp

PDB Compounds: (A:) Glutamine-tRNA ligase

SCOPe Domain Sequences for d5zdoa2:

Sequence; same for both SEQRES and ATOM records:

>d5zdoa2 b.53.1.0 (A:338-543) automated matches {Thermus thermophilus [TaxId: 300852]}
aprvlgvvdplkvvltnyegeewieapywprdipkegtrplpfspelyiertdfslnppk
gwkrlapgqrvrlrhayvieledvveeggevrllkarivpgtlganpedgvrpkgvihwv
sarhalpvefrlygrlfrtkdpeeggdflqnlnpealvvkrgfiepsvaqdpedtryqle
rlgyfwrdpvdsrpealvmnrivplk

Timeline for d5zdoa2:

• d5zdoa2 first appeared in SCOPe 2.07