![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
![]() | Protein automated matches [190459] (61 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [360920] (3 PDB entries) |
![]() | Domain d5zdka1: 5zdk A:1-337 [360921] Other proteins in same PDB: d5zdka2 automated match to d4jxxa1 complexed with atp, cl, cs, mg |
PDB Entry: 5zdk (more details), 2.45 Å
SCOPe Domain Sequences for d5zdka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zdka1 c.26.1.0 (A:1-337) automated matches {Thermus thermophilus [TaxId: 300852]} mglvpecfitelverdlkegkyaklvtrfppepngylhigharsivlnfglaqdyggecn lrfddtnpetekeeyaraieedvrwlgfrptrvlyasdyfetmyqcalvliqegkayvdd lpeeemselraqgkpspyrersveenlelfermrrgefptgsrvlrakidpahpnfklrd pvlyrivhaphyhvgdrwviypmydfahpledfiegvthslctlefennrtvydwvienl kgkcglptsprphqyefarldlshtvlskrkliklveggyvsgwddprlptlrglrrrgv rpeaivefvrktgisrneaqiemdlfeevvrddlnpi
Timeline for d5zdka1: