Lineage for d6gued2 (6gue D:310-432)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718557Protein automated matches [227027] (3 species)
    not a true protein
  7. 2718558Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries)
  8. 2718574Domain d6gued2: 6gue D:310-432 [360919]
    Other proteins in same PDB: d6guea1, d6guea2, d6guec1, d6guec2
    automated match to d3ddqb2
    complexed with fb8

Details for d6gued2

PDB Entry: 6gue (more details), 1.99 Å

PDB Description: cdk2/cyclina in complex with azd5438
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d6gued2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gued2 a.74.1.1 (D:310-432) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvtg
qswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppet
lnv

SCOPe Domain Coordinates for d6gued2:

Click to download the PDB-style file with coordinates for d6gued2.
(The format of our PDB-style files is described here.)

Timeline for d6gued2: