SCOPe 2.07: Domain d6gued1: 6gue D:171-309

Lineage for d6gued1 (6gue D:171-309)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries)

8. Domain d6gued1: 6gue D:171-309 [360918]
   Other proteins in same PDB: d6guea1, d6guea2, d6guec1, d6guec2
   automated match to d3ddqb1
   complexed with fb8

Details for d6gued1

PDB Entry: 6gue, 1.99 Å

PDB Description: cdk2/cyclina in complex with azd5438

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d6gued1:

Sequence; same for both SEQRES and ATOM records:

>d6gued1 a.74.1.1 (D:171-309) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
vlrmehlvlkvlafdlaap

Timeline for d6gued1:

• d6gued1 is new in SCOPe 2.07-stable
  
• d6gued1 appears in the current release, SCOPe 2.08