SCOPe 2.08: Domain d5z6ua_: 5z6u A:

Lineage for d5z6ua_ (5z6u A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein automated matches [190169] (7 species)
   not a true protein

7. Species Scheffersomyces stipitis [TaxId:322104] [360899] (2 PDB entries)

8. Domain d5z6ua_: 5z6u A: [360912]
   automated match to d1mi3a_
   complexed with gol

Details for d5z6ua_

PDB Entry: 5z6u, 1.95 Å

PDB Description: crystal structure of d-xylose reductase from scheffersomyces stipitis

PDB Compounds: (A:) NAD(P)H-dependent D-xylose reductase

SCOPe Domain Sequences for d5z6ua_:

Sequence; same for both SEQRES and ATOM records:

>d5z6ua_ c.1.7.1 (A:) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
mpsiklnsgydmpavgfgcwkvdvdtcseqiyraiktgyrlfdgaedyaneklvgagvkk
aidegivkredlfltsklwnnyhhpdnvekalnrtlsdlqvdyvdlflihfpvtfkfvpl
eekyppgfycgkgdnfdyedvpiletwkaleklvkagkirsigvsnfpgallldllrgat
ikpsvlqvehhpylqqprliefaqsrgiavtayssfgpqsfvelnqgralntsplfenet
ikaiaakhgkspaqvllrwssqrgiaiipksntvprllenkdvnsfdldeqdfadiakld
inlrfndpwdwdkipifv

Timeline for d5z6ua_:

• d5z6ua_ first appeared in SCOPe 2.07