Lineage for d5yn6b_ (5yn6 B:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
    binds two zinc ion per subunit; forms a dodecameric shell
  4. Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) (S)
    automatically mapped to Pfam PF09401
  5. Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
    partly covered by PfamB PB001266
  6. Protein Nonstructural protein 10, NSP10 [144248] (2 species)
  7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [419794] (12 PDB entries)
  8. Domain d5yn6b_: 5yn6 B: [360911]
    Other proteins in same PDB: d5yn6a_
    automated match to d2xyqb_
    complexed with sam, zn

Details for d5yn6b_

PDB Entry: 5yn6 (more details), 1.95 Å

PDB Description: crystal structure of mers-cov nsp10/nsp16 complex bound to sam
PDB Compounds: (B:) nsp10 protein

SCOPe Domain Sequences for d5yn6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yn6b_ g.86.1.1 (B:) Nonstructural protein 10, NSP10 {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
ssvlslvnftvdpqkayldfvnaggapltncvkmltpktgtgiaisvkpestadqetygg
asvclycrahiehpdvsgvckykgkfvqipaqcvrdpvgfclsntpcnvcqywigygcnc

SCOPe Domain Coordinates for d5yn6b_ are not available.

Timeline for d5yn6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5yn6a_