SCOPe 2.08: Domain d5ynjb_: 5ynj B:

Lineage for d5ynjb_ (5ynj B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
   binds two zinc ion per subunit; forms a dodecameric shell

4. Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family)
   automatically mapped to Pfam PF09401

5. Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
   partly covered by PfamB PB001266

6. Protein Nonstructural protein 10, NSP10 [144248] (2 species)

7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [419794] (12 PDB entries)

8. Domain d5ynjb_: 5ynj B: [360910]
   Other proteins in same PDB: d5ynja_
   automated match to d2xyqb_
   complexed with gtg, zn

Details for d5ynjb_

PDB Entry: 5ynj, 2.04 Å

PDB Description: crystal structure of mers-cov nsp16/nsp10 complex bound to m7gpppg

PDB Compounds: (B:) nsp10 protein

SCOPe Domain Sequences for d5ynjb_:

Sequence; same for both SEQRES and ATOM records:

>d5ynjb_ g.86.1.1 (B:) Nonstructural protein 10, NSP10 {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
fasnssvlslvnftvdpqkayldfvnaggapltncvkmltpktgtgiaisvkpestadqe
tyggasvclycrahiehpdvsgvckykgkfvqipaqcvrdpvgfclsntpcnvcqywigy
gcnc

Timeline for d5ynjb_:

• d5ynjb_ first appeared in SCOPe 2.07