Lineage for d6hf5a_ (6hf5 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. Protein automated matches [190079] (12 species)
    not a true protein
  7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (74 PDB entries)
  8. Domain d6hf5a_: 6hf5 A: [360891]
    automated match to d5lsca_
    complexed with act, g1n, zn

Details for d6hf5a_

PDB Entry: 6hf5 (more details), 1.8 Å

PDB Description: crystal structure of the acquired vim-2 metallo-beta-lactamase in complex with ant-431 inhibitor
PDB Compounds: (A:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d6hf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hf5a_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr

SCOPe Domain Coordinates for d6hf5a_ are not available.

Timeline for d6hf5a_: