SCOPe 2.07: Domain d5yx1a2: 5yx1 A:76-199

Lineage for d5yx1a2 (5yx1 A:76-199)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (15 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d5yx1a2: 5yx1 A:76-199 [360885]
   Other proteins in same PDB: d5yx1a1, d5yx1b1, d5yx1c1, d5yx1d1
   automated match to d2cvda1
   complexed with gol, gsh, mg, ux4

Details for d5yx1a2

PDB Entry: 5yx1, 1.39 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase in complex with u004

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5yx1a2:

Sequence; same for both SEQRES and ATOM records:

>d5yx1a2 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d5yx1a2:

• d5yx1a2 is new in SCOPe 2.07-stable
  
• d5yx1a2 appears in the current release, SCOPe 2.08