SCOPe 2.08: Domain d5yx1a1: 5yx1 A:2-75

Lineage for d5yx1a1 (5yx1 A:2-75)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89705] (16 PDB entries)
   Uniprot O60760
   synonym: hematopoietic prostaglandin D synthase

8. Domain d5yx1a1: 5yx1 A:2-75 [360884]
   Other proteins in same PDB: d5yx1a2, d5yx1b2, d5yx1c2, d5yx1d2
   automated match to d2cvda2
   complexed with gol, gsh, mg, ux4

Details for d5yx1a1

PDB Entry: 5yx1, 1.39 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase in complex with u004

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5yx1a1:

Sequence; same for both SEQRES and ATOM records:

>d5yx1a1 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

Timeline for d5yx1a1:

• d5yx1a1 first appeared in SCOPe 2.07