Lineage for d6n41a2 (6n41 A:330-494)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3042005Species Influenza a virus [TaxId:936099] [360845] (1 PDB entry)
  8. 3042006Domain d6n41a2: 6n41 A:330-494 [360854]
    Other proteins in same PDB: d6n41a1, d6n41a3, d6n41b1, d6n41b3, d6n41c1, d6n41c3
    automated match to d4wsrd2
    complexed with edo, nag, peg

Details for d6n41a2

PDB Entry: 6n41 (more details), 2.5 Å

PDB Description: crystal structure of invbm.18715.a.kn11: influenza hemagglutinin from strain a/netherlands/002p1/1951
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6n41a2:

Sequence, based on SEQRES records: (download)

>d6n41a2 h.3.1.0 (A:330-494) automated matches {Influenza a virus [TaxId: 936099]}
glfgaiagfieggwtgmmdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvknqlrnnakelgngcfefyhkcdnecmesvkngtydypkysee

Sequence, based on observed residues (ATOM records): (download)

>d6n41a2 h.3.1.0 (A:330-494) automated matches {Influenza a virus [TaxId: 936099]}
glfgaiagfieggwtgmmdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvknqlrnnakelgngcfefyhkcdnecmesvkngtydysee

SCOPe Domain Coordinates for d6n41a2:

Click to download the PDB-style file with coordinates for d6n41a2.
(The format of our PDB-style files is described here.)

Timeline for d6n41a2: