Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza a virus [TaxId:936099] [360845] (1 PDB entry) |
Domain d6n41c2: 6n41 C:330-485 [360852] Other proteins in same PDB: d6n41a1, d6n41a3, d6n41b1, d6n41b3, d6n41c1, d6n41c3 automated match to d4wsrd2 complexed with bma, edo, man, nag, peg |
PDB Entry: 6n41 (more details), 2.5 Å
SCOPe Domain Sequences for d6n41c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n41c2 h.3.1.0 (C:330-485) automated matches {Influenza a virus [TaxId: 936099]} glfgaiagfieggwtgmmdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn tqftavgkefnklekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye kvknqlrnnakelgngcfefyhkcdnecmesvkngt
Timeline for d6n41c2: