Lineage for d6n41c2 (6n41 C:330-485)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646587Species Influenza a virus [TaxId:936099] [360845] (1 PDB entry)
  8. 2646590Domain d6n41c2: 6n41 C:330-485 [360852]
    Other proteins in same PDB: d6n41a1, d6n41a3, d6n41b1, d6n41b3, d6n41c1, d6n41c3
    automated match to d4wsrd2
    complexed with bma, edo, man, nag, peg

Details for d6n41c2

PDB Entry: 6n41 (more details), 2.5 Å

PDB Description: crystal structure of invbm.18715.a.kn11: influenza hemagglutinin from strain a/netherlands/002p1/1951
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6n41c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n41c2 h.3.1.0 (C:330-485) automated matches {Influenza a virus [TaxId: 936099]}
glfgaiagfieggwtgmmdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvknqlrnnakelgngcfefyhkcdnecmesvkngt

SCOPe Domain Coordinates for d6n41c2:

Click to download the PDB-style file with coordinates for d6n41c2.
(The format of our PDB-style files is described here.)

Timeline for d6n41c2: