Lineage for d6n41c1 (6n41 C:3-324)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386325Species Influenza a virus [TaxId:936099] [360843] (1 PDB entry)
  8. 2386328Domain d6n41c1: 6n41 C:3-324 [360851]
    Other proteins in same PDB: d6n41a2, d6n41a3, d6n41b2, d6n41b3, d6n41c2, d6n41c3
    automated match to d4wsrd1
    complexed with bma, edo, man, nag, peg

Details for d6n41c1

PDB Entry: 6n41 (more details), 2.5 Å

PDB Description: crystal structure of invbm.18715.a.kn11: influenza hemagglutinin from strain a/netherlands/002p1/1951
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6n41c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n41c1 b.19.1.0 (C:3-324) automated matches {Influenza a virus [TaxId: 936099]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgkcniagw
ilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpke
sswpkhnttrgvtaacsharkssfyknllwlteangsypnlsksyvnnqekevlvlwgvh
hpsniedqrtlyrkenayvsvvssnynrrftpeiaerpkvrnqagrmnyywtllepgdti
ifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpvti
gecpkyvkstklrmvtglrnip

SCOPe Domain Coordinates for d6n41c1:

Click to download the PDB-style file with coordinates for d6n41c1.
(The format of our PDB-style files is described here.)

Timeline for d6n41c1: