Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza a virus [TaxId:936099] [360843] (1 PDB entry) |
Domain d6n41c1: 6n41 C:3-324 [360851] Other proteins in same PDB: d6n41a2, d6n41a3, d6n41b2, d6n41b3, d6n41c2, d6n41c3 automated match to d4wsrd1 complexed with bma, edo, man, nag, peg |
PDB Entry: 6n41 (more details), 2.5 Å
SCOPe Domain Sequences for d6n41c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n41c1 b.19.1.0 (C:3-324) automated matches {Influenza a virus [TaxId: 936099]} dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgkcniagw ilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpke sswpkhnttrgvtaacsharkssfyknllwlteangsypnlsksyvnnqekevlvlwgvh hpsniedqrtlyrkenayvsvvssnynrrftpeiaerpkvrnqagrmnyywtllepgdti ifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpvti gecpkyvkstklrmvtglrnip
Timeline for d6n41c1: