Lineage for d6gj4a2 (6gj4 A:246-437)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (70 PDB entries)
  8. 3060788Domain d6gj4a2: 6gj4 A:246-437 [360850]
    Other proteins in same PDB: d6gj4a1, d6gj4b1, d6gj4c1, d6gj4d1, d6gj4e_, d6gj4f1, d6gj4f2, d6gj4f3
    automated match to d4i50a2
    complexed with acp, ca, ezw, gdp, gtp, mes, mg

Details for d6gj4a2

PDB Entry: 6gj4 (more details), 2.4 Å

PDB Description: tubulin-6j complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6gj4a2:

Sequence, based on SEQRES records: (download)

>d6gj4a2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Sequence, based on observed residues (ATOM records): (download)

>d6gj4a2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekaeqlsvaeitnacfepanqmvkcdp
rhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggd
lakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaa
lekdyeevgv

SCOPe Domain Coordinates for d6gj4a2:

Click to download the PDB-style file with coordinates for d6gj4a2.
(The format of our PDB-style files is described here.)

Timeline for d6gj4a2:

  • d6gj4a2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06