SCOPe 2.06: Domain d3hoha_: 3hoh A:

Lineage for d3hoha_ (3hoh A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d3hoha_: 3hoh A: [36085]
   complexed with 2gp, ca; mutant

Details for d3hoha_

PDB Entry: 3hoh, 1.95 Å

PDB Description: ribonuclease t1 (thr93gln mutant) complexed with 2'gmp

PDB Compounds: (A:) protein (ribonuclease t1)

SCOPe Domain Sequences for d3hoha_:

Sequence; same for both SEQRES and ATOM records:

>d3hoha_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithqgasgnnfvect

Timeline for d3hoha_:

• d3hoha_ first appeared (with stable ids) in SCOP 1.55
  
• d3hoha_ appears in SCOPe 2.05
  
• d3hoha_ appears in SCOPe 2.07
  
• d3hoha_ appears in the current release, SCOPe 2.08