Lineage for d3hoha_ (3hoh A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28524Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 28525Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 28526Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 28668Protein RNase T1 [53939] (2 species)
  7. 28671Species Aspergillus oryzae [TaxId:5062] [53940] (54 PDB entries)
  8. 28708Domain d3hoha_: 3hoh A: [36085]

Details for d3hoha_

PDB Entry: 3hoh (more details), 1.95 Å

PDB Description: ribonuclease t1 (thr93gln mutant) complexed with 2'gmp

SCOP Domain Sequences for d3hoha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hoha_ d.1.1.1 (A:) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithqgasgnnfvect

SCOP Domain Coordinates for d3hoha_:

Click to download the PDB-style file with coordinates for d3hoha_.
(The format of our PDB-style files is described here.)

Timeline for d3hoha_: