SCOPe 2.05: Domain d1birb_: 1bir B:

Lineage for d1birb_ (1bir B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d1birb_: 1bir B: [36084]
   complexed with 2gp, ca; mutant

Details for d1birb_

PDB Entry: 1bir, 1.8 Å

PDB Description: ribonuclease t1, phe 100 to ala mutant complexed with 2' gmp

PDB Compounds: (B:) ribonuclease t1

SCOPe Domain Sequences for d1birb_:

Sequence; same for both SEQRES and ATOM records:

>d1birb_ d.1.1.4 (B:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnavect

Timeline for d1birb_:

• d1birb_ first appeared (with stable ids) in SCOP 1.55
  
• d1birb_ appears in SCOPe 2.04
  
• d1birb_ appears in SCOPe 2.06
  
• d1birb_ appears in the current release, SCOPe 2.08