Lineage for d6i1cc_ (6i1c C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879553Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [348632] (10 PDB entries)
  8. 2879569Domain d6i1cc_: 6i1c C: [360829]
    automated match to d1ti3a_

Details for d6i1cc_

PDB Entry: 6i1c (more details), 2.01 Å

PDB Description: crystal structure of chlamydomonas reinhardtii thioredoxin f2
PDB Compounds: (C:) thioredoxin f2

SCOPe Domain Sequences for d6i1cc_:

Sequence, based on SEQRES records: (download)

>d6i1cc_ c.47.1.0 (C:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gqgllqldkdtfwpyleqqqdtlvvvdfytdwcgpckliypelvklsqertdvrfvkvnc
nksnkelgmqlaikvaptfhlyrnktkvadmtgakmdklialinqhqppk

Sequence, based on observed residues (ATOM records): (download)

>d6i1cc_ c.47.1.0 (C:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gqgllqldkdtfwpyleqqdtlvvvdfytdwcgpckliypelvlsqertdvrfvkvncnk
snkelgmqlaikvatfhlyrnktkvadmtgakmdklialinqhqppk

SCOPe Domain Coordinates for d6i1cc_:

Click to download the PDB-style file with coordinates for d6i1cc_.
(The format of our PDB-style files is described here.)

Timeline for d6i1cc_: