![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein automated matches [227027] (3 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries) |
![]() | Domain d6gueb2: 6gue B:310-432 [360828] Other proteins in same PDB: d6guea1, d6guea2, d6guec1, d6guec2 automated match to d3ddqb2 complexed with fb8 |
PDB Entry: 6gue (more details), 1.99 Å
SCOPe Domain Sequences for d6gueb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gueb2 a.74.1.1 (B:310-432) automated matches {Cow (Bos taurus) [TaxId: 9913]} tinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvtg qswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppet lnv
Timeline for d6gueb2: